Login

Leptin Recombinant Protein

CAT:
209-500-070
Size:
500 µg
Price:
Ask
For price, please contact [email protected]
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Leptin Recombinant Protein - image 1

Leptin Recombinant Protein

  • Description: Recombinant porcine leptin, one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa, Recombinant porcine leptin was purified by proprietary chromatographic techniques, see Raver et al. Prot. Express. Purif. 19, 30-40 (2000).
  • Synonyms: Lep; ob; obese
  • CAS Number: 9000-83-3
  • NCBI Gene ID: 396832
  • UniProt: Q29406
  • Accession Number: NP_999005.1
  • Accession Number mRNA: NM_213840.1
  • Host: E. coli
  • Origin Species: Porcine
  • Species Reactivity: Porcine
  • Sequence: AVPIWRVQDDTKTLIKTIVTRISDISHMQSVSSKQRVTGLDFIPGLHPVLSLSKMDQTLAIYQQILTSLPSRNVIQISNDLENLRDLLHLLASSKSCPLPQARALETLESLGGVLEASLYSTEVVALSRLQGALQDMLRQLDLSPGC
  • Detection Range: Recombinant porcine leptin is fully biologically active as evidenced by inducing proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor.
  • Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
  • Purity: > 98.0% as determined by Gel filtration and SDS-PAGE gel.
  • Length: 146
  • Form: Lyophilized
  • Reconstitution: It is recommended to reconstitute the lyophilized recombinant porcine leptin in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
  • Molecular Weight: 16.0 kDa
  • Shipping Conditions: Room Temperature