Login

Goat anti-GAPDH Polyclonal antibody

CAT:
894-AB0049-500
Size:
1 mg
Price:
Ask
For price, please contact [email protected]
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Goat anti-GAPDH Polyclonal antibody - image 1

Goat anti-GAPDH Polyclonal antibody

  • Description: Goat polyclonal to GAPDH (glyceraldehyde 3-phosphate dehydrogenase). GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains.
  • Specifications: Detects a band of 37 kDa by Western blot in the following human (293A, HMEC-1, U-118, HaCat), rat (TR-iBRB), mouse (AtT-20, Hepa), canine (D17) and monkey (COS-7) whole cell lysates.
  • Product Name Alternative: glyceraldehyde 3-phosphate dehydrogenase, glyceraldehyde-3-phosphate dehydrogenase, G3PD, GAPD, HGNC:4141, GAPDH antibody.
  • CAS Number: 9007-83-4
  • UNSPSC Description: Glyceraldehyde-3-phosphate dehydrogenase
  • Volume: 500 µL
  • Gene ID: ENSG00000111640
  • Accession Number: ENSG00000111640
  • Host: Goat
  • Antigen Species: Human
  • Reactivity: Human, mouse, rat, fish, bovine, canine, chicken/avian, donkey, feline, goat, guinea pig, hamster, horse, porcine, rabbit, sheep, simian, other
  • Immunogen: Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli.
  • Target Antigen: Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli.
  • Immunogen Type: Recombinant protein
  • Target: Anti-GAPDH
  • Clonality: Polyclonal
  • Isotype: IgG
  • Conjugation: Unconjugated
  • Type: Primary
  • Sequence: SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
  • Applications: WB, IF, IHC-P, IHC-F
  • Purification: Epitope affinity purified
  • Concentration: 2 mg/mL
  • Dilution: WB:1:500-1:5,000, IF:1:50-1:250, IHC-P:1:200-1:1,000, IHC-F:1:200-1:1,000
  • Form: Polyclonal antibody supplied as a 200 or 500 µl (2 mg/mL) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
  • Buffer: PBS, 20% glycerol and 0.05% sodium azide
  • References & Citations: 1. Ferreira JV, Soares AR, Ramalho J, et al. Sci Adv 2022 Mar. PMID: 35333565 2. Martins-Marques T, Costa MC, Catarino S, et al. EMBO Rep 2022 May. PMID: 35593040 3. Wu Q, Sacomboio E, Souza LV, et al. bioRxiv 2022 4. Levin JB, Borodinsky LN. Cell Calcium 2022 Mar. PMID: 35074688 5. Monteiro-Alfredo T, Oliveira S, Amaro A, et al. Nutrients 2021 Aug. PMID: 34445015 6. Martins-Marques T, Ribeiro-Rodrigues T, de Jager SC, et al. Life Sci Alliance 2020 Oct. PMID: 33097557 7. Lee ACK, PhD Thesis, California University, Davis, United States 2020 8. Martins SGR, MSc Thesis, NOVA University of Lisbon, Portugal 2019 9. Ferreira JV, Rosa Soares A, Ramalho JS, et al. PLoS One 2019 Oct. PMID:31613922 10. Alenquer M, Vale-Costa S, Etibor TA, et al. Nat Commun 2019 Apr. PMID:30967547 11. Sanzà P, Evans RD, Briggs DA, et al. J Cell Sci 2019 Apr. PMID:30898842 12. Aires ID, Boia R, Rodrigues-Neves AC, et al. Glia 2019 Jan. PMID:30667095 13. Barbeitos JP, MSc Thesis, University of Coimbra, Portugal 2018 14. Alenquer M, Vale-Costa S, Sousa AL, et al. bioRxiv 410373; Sept 2018 15. Alzahofi N, Robinson CL, Welz T, et al. bioRxiv 314153; May 2018 16. Ribeiro ST, Tesio M, Ribot JC, et al. Leukemia 2017 Jul. PMID:27899804 17. Santarino IB, Viegas MS, Domingues NS, et al. Sci Rep 2017 Jul. PMID:28724916 18. Ribeiro STF, PhD Thesis, University of Lisbon, Portugal 2017 19. Robinson CL, Evans RD, Briggs DA, et al. J Cell Sci 2017 May. PMID:28490438 20. Ramalho AR, Toscano A, Pereira P, et al. Rev Port Cardiol 2017 May. PMID:28479269 21. Vale-Costa S, Alenquer M, Sousa AL, et al. J Cell Sci 2016 Mar. PMID:26940915 22. Encarnação M, Espada L, Escrevente C, et al. J Cell Biol 2016 Jun 20. PMID: 27325790 23. Ferreira JV, Soares AR, Ramalho JS, et al. Scientific Reports 2015 May. PMID:25958982 24. Ferreira RRS, MSc Thesis, University of Coimbra, Portugal 2015 25. Paiva RA, MSc Thesis, University of Coimbra, Portugal 2015 26. Casalou C, Seixas C, Portelinha A, et al. J Cell Sci 2014 Jun. PMID:24777479 27. Ribeiro-Rodrigues TM, Catarino S, Marques C, et al. FASEB J 2014 Nov. PMID:25070368 28. Moreiras HAF, MSc Thesis, University of Lisbon, Portugal 2014
  • Storage Conditions: For continuous use, store at 2-8 deg;C for one-two days. For extended storage, store in -20 deg;C freezer. Working dilution samples should be discarded if not used within 12 hours.