Login

Dendrotoxin K (TFA)

CAT:
804-HY-P3089A-01
Size:
100 µg
Price:
Ask
For price, please contact [email protected]
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Dendrotoxin K (TFA) - image 1

Dendrotoxin K (TFA)

  • UNSPSC Description: Dendrotoxin K TFA is a Kv1.1 channel blocker. Dendrotoxin K TFA determines glutamate release in CA3 neurons in a time-dependent manner through the control of the presynaptic spike waveform[1].
  • Target Antigen: Potassium Channel
  • Type: Peptides
  • Related Pathways: Membrane Transporter/Ion Channel
  • Applications: Neuroscience-Neuromodulation
  • Field of Research: Others
  • Assay Protocol: https://www.medchemexpress.com/dendrotoxin-k-tfa.html
  • Purity: 98.0
  • Solubility: 10 mM in DMSO
  • Smiles: [AAKYCKLPLRIGPCKRKIPSFYYKWKAKQCLPFDYSGCGGNANRFKTIEECRRTCVG (Disulfide bridge:Cys5-Cys55,Cys14-Cys38,Cys30-Cys51) (TFA salt)]
  • Molecular Weight: 6559.66 (free base)
  • References & Citations: [1]Bialowas A, et al. Analog modulation of spike-evoked transmission in CA3 circuits is determined by axonal Kv1.1 channels in a time-dependent manner. Eur J Neurosci. 2015 Feb;41(3):293-304.
  • Shipping Conditions: Blue Ice
  • Storage Conditions: -80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture and light, under nitrogen)
  • Clinical Information: No Development Reported