Recombinant Human Alpha-2-HS-glycoprotein (AHSG) , partial (Active)

Recombinant Human Alpha-2-HS-glycoprotein (AHSG) , partial (Active)

• CAS Number: 9000-83-3
• Gene Name: Fetuin A
• UniProt: P02765
• Expression Region: 19-300aa&341-367aa
• Organism: Homo sapiens
• Target Sequence: TVVQPSVGAAAGPVVPPCPGRIRHFKV&APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVL
• Tag: Tag free
• Source: Mammalian cell
• Field of Research: Others
• Assay Type: Active Protein & In Stock Protein
• Endotoxin: ≤0.5EU/mg by the LAL method
• Purity: Greater than 95% as determined by SDS-PAGE.
• Activity: Yes
• Bioactivity: Measured in a cell proliferation assay using B16-F1 cells. Human Fetuin A stimulates adhesion of B16-F1 cells. The ED50 for this effect is 50-200 μg/mL. Optimal concentration depends on cell type as well as the application or research objectives.
• Length: Partial
• Form: Lyophilized powder
• Buffer: Lyophilized from a 0.2 μm filtered solution containing 10 mM PB, pH 7.4
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Molecular Weight: 32.9 kDa
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.