Login

Recombinant Human CD70 antigen (CD70) , partial (Active)

CAT:
399-CSB-MP004954HU1-03
Size:
1 mg
Price:
Ask
For price, please contact [email protected]
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human CD70 antigen (CD70) , partial (Active) - image 1
Recombinant Human CD70 antigen (CD70) , partial (Active) - image 2
Recombinant Human CD70 antigen (CD70) , partial (Active) - image 3
Recombinant Human CD70 antigen (CD70) , partial (Active) - image 4
Thumbnail 1
Thumbnail 2
Thumbnail 3
Thumbnail 4

Recombinant Human CD70 antigen (CD70) , partial (Active)

  • CAS Number: 9000-83-3
  • Gene Name: CD70
  • UniProt: P32970
  • Expression Region: 52-193aa
  • Organism: Homo sapiens
  • Target Sequence: SLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
  • Tag: N-terminal 10xHis-tagged
  • Source: Mammalian cell
  • Field of Research: Cancer
  • Assay Type: Active Protein & In Stock Protein
  • Relevance: Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. LI-cadherin may have a role in the morphological organization of liver and intestine. Involved in intestinal peptide transport.
  • Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
  • Purity: Greater than 90% as determined by SDS-PAGE.
  • Activity: Yes
  • Bioactivity: ①Measured by its binding ability in a functional ELISA. Immobilized Human CD70 at 2 μg/mL can bind Anti-CD70 antibody, the EC50 is 2.414-3.196 ng/mL.
  • Length: Partial
  • Form: Lyophilized powder
  • Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
  • Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight: 22.7 kDa
  • References & Citations: "A clinicopathological study on the expression of cadherin-17 and caudal-related homeobox transcription factor (CDX2) in human gastric carcinoma." Ge J., Chen Z., Wu S., Yuan W., Hu B., Chen Z. Clin Oncol (R Coll Radiol) 20:275-283 (2008)
  • Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
  • Protein Length: Partial