Login

RHOB Antibody

CAT:
800-RQ4915
Size:
100 µg
Price:
Ask
For price, please contact [email protected]
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
RHOB Antibody - image 1
RHOB Antibody - image 2
Thumbnail 1
Thumbnail 2

RHOB Antibody

  • Description: Ras homolog gene family, member B, also known as RHOB, is a protein which in humans is encoded by the RHOB gene. This gene is mapped to 2p24.1. It is a member of the Rho GTP-binding protein family. And RHOB has been shown to interact with CIT, ARHGEF3, ARHGDIG and RHPN2. RHOB plays a negative role in tumorigenesis as deletion causes tumor formation. Also, it serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis.
  • CAS Number: 9007-83-4
  • UniProt: P62745
  • Host: Rabbit
  • Immunogen: Amino acids NKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLE from the human protein were used as the immunogen for the RHOB antibody.
  • Clonality: Polyclonal
  • Isotype: IgG
  • Applications: WB, IHC-P, IF
  • Format: Antigen affinity purified
  • Buffer: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
  • Reconstitution: After reconstitution, the RHOB antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Limitations: This RHOB antibody is available for research use only.

Datasheet