RHOB Antibody
CAT:
800-RQ4915
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




RHOB Antibody
- Description: Ras homolog gene family, member B, also known as RHOB, is a protein which in humans is encoded by the RHOB gene. This gene is mapped to 2p24.1. It is a member of the Rho GTP-binding protein family. And RHOB has been shown to interact with CIT, ARHGEF3, ARHGDIG and RHPN2. RHOB plays a negative role in tumorigenesis as deletion causes tumor formation. Also, it serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis.
- CAS Number: 9007-83-4
- UniProt: P62745
- Host: Rabbit
- Immunogen: Amino acids NKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLE from the human protein were used as the immunogen for the RHOB antibody.
- Clonality: Polyclonal
- Isotype: IgG
- Applications: WB, IHC-P, IF
- Format: Antigen affinity purified
- Buffer: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
- Reconstitution: After reconstitution, the RHOB antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
- Limitations: This RHOB antibody is available for research use only.