Recombinant Mouse Dipeptidase 3 (Dpep3)
CAT:
399-CSB-MP007125MO-01
Size:
20 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No






Recombinant Mouse Dipeptidase 3 (Dpep3)
- CAS Number: 9000-83-3
- Gene Name: Dpep3
- UniProt: Q9DA79
- Expression Region: 36-462aa
- Organism: Mus musculus
- Target Sequence: TCTLTTPSPSSAPTTPEASNATTAPGIPNDTATSGVTSDPRLREQALALMRDFPLVDGHNDLPLLLRELFQNQLQDVNLRNFTRGQTNLDRLRDGLVGAQFWSAYIPCQTQDRDAVRLALEQIDLIRRMCSAYPELELVTSADGLNNTQKLACLIGVEGGHSLDTSLAVLRSFYELGVRYLTLTFTCSTPWAESATKFRHHFYTNISGLTSFGEKVVEEMNRLGMMIDLSHASDTLVKQTLEVSQAPVIFSHSAARSVCDNLLNIPDDILQLLKKNGGIVMVTLSMGVLQCSLFANVSTVADHFDHIRTVIGSEFIGIGGSYDGSGRFPQGLEDVSTYPVLIEELLSRGWDERELQGVLRGNLLRVFRQVEQVREKSLGQSPVEVKFPERQQSNTCHSHLLPQPQEDQHQDTHLKVTKLPNILQRAS
- Tag: C-terminal 10xHis-tagged
- Source: Mammalian cell
- Field of Research: Cell Biology
- Assay Type: Developed Protein
- Relevance: Lacks dipeptidase activity and is unable to hydrolyze cystinyl-bis-glycine. The absence of activity may be due to the inability of serine (instead of aspartate found in DPEP1/2) at position 356 to function as the acid/base catalyst and activate the nucleophilic water/hydroxide. Does not hydrolyze leukotriene D4 (LTD4) into leukotriene E4 (LTE4). Does not hydrolyze the beta-lactam antibiotic imipenem.
- Purity: Greater than 95% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Full Length of Mature Protein
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 48.7 kDa
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.