Login

Recombinant Helicobacter pylori LPP20 lipoprotein (lpp20)

CAT:
399-CSB-EP362991HCQ-03
Size:
1 mg
Price:
Ask
For price, please contact [email protected]
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Helicobacter pylori LPP20 lipoprotein (lpp20) - image 1
Recombinant Helicobacter pylori LPP20 lipoprotein (lpp20) - image 2
Thumbnail 1
Thumbnail 2

Recombinant Helicobacter pylori LPP20 lipoprotein (lpp20)

  • CAS Number: 9000-83-3
  • Gene Name: lpp20
  • UniProt: P0A0V1
  • Expression Region: 22-175aa
  • Organism: Helicobacter pylori (strain J99 / ATCC 700824) (Campylobacter pylori J99)
  • Target Sequence: CSHAPKSGISKSNKAYKEATKGAPDWVVGDLEKVAKYEKYSGVFLGRAEDLITNNDVDYSTNQATAKARANLAANLKSTLQKDLENEKTRTVDASGKRSISGTDTEKISQLVDKELIASKMLARYVGKDRVFVLVGLDKQIVDKVREELGMVKK
  • Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
  • Source: E.coli
  • Field of Research: Others
  • Assay Type: In Stock Protein
  • Relevance: Could play a role in the pathogenesis of H.pylori by serving as an inflammatory mediator.
  • Purity: Greater than 90% as determined by SDS-PAGE.
  • Activity: Not Test
  • Length: Full Length of Mature Protein
  • Form: Liquid or Lyophilized powder
  • Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight: 24.4 kDa
  • References & Citations: "Helicobacter pylori antigenic Lpp20 is a structural homologue of Tipalpha and promotes epithelial-mesenchymal transition." Vallese F., Mishra N.M., Pagliari M., Berto P., Codolo G., de Bernard M., Zanotti G. Biochim Biophys Acta Gen Subj 1861:3263-3271 (2017)
  • Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.