CNTF (Animal Free) Recombinant Protein
CAT:
209-R20-001S-AF
Size:
5 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No

CNTF (Animal Free) Recombinant Protein
- Description: CNTF is a potent neural factor that was originally characterized as a vital factor for the survival of chick ciliary neurons in vitro. CNTF is also important for the survival of other neural cell types, including primary sensory neurons, motor neurons, basal forebrain neurons and type 2 astrocytes. CNTF is highly conserved across species and exhibits cross-species bioactivity. Recombinant Rat CNTF is synthesized as a 199 amino acid polypeptide (22.7 kDa) lacking a hydrophobic N-terminal signal for secretion.
- Synonyms: Cntf
- CAS Number: 9000-83-3
- NCBI Gene ID: 25707
- UniProt: P20294
- Accession Number: NP_037298.1
- Accession Number mRNA: NM_013166.1
- Gene Location: 1q43
- Host: E. coli
- Origin Species: Rat
- Species Reactivity: Frog, Human, Mouse, Rat
- Sequence: AFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
- Detection Range: Determined by its ability to stimulate proliferation of human TF-1 cells using a concentration range of 25.0-35.0 ng/ml.
- Endotoxin: < 0.01 ng/ug of protein (< 0.1 EU/ug)
- Purity: ≥ 98% by SDS-PAGE gel and HPLC analyses.
- Length: 199
- Form: Lyophilized
- Molecular Weight: 22.7 kDa
- Shipping Conditions: Room Temperature