Recombinant Mouse Beta-defensin 6 (Defb6)

• CAS Number: 9000-83-3
• Gene Name: Defb6
• UniProt: Q91VD6
• Expression Region: 23-63aa
• Organism: Mus musculus
• Target Sequence: QLINSPVTCMSYGGSCQRSCNGGFRLGGHCGHPKIRCCRRK
• Tag: N-terminal GST-tagged
• Source: E.coli
• Field of Research: Immunology
• Assay Type: Developed Protein
• Relevance: Has potent antibacterial activity against E.coli (ATCC 25922).
• Purity: Greater than 85% as determined by SDS-PAGE.
• Activity: Not Test
• Length: Full Length of Mature Protein
• Form: Liquid or Lyophilized powder
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Molecular Weight: 31.1 kDa
• References & Citations: "A novel mouse beta-defensin, mBD-6, predominantly expressed in skeletal muscle." Yamaguchi Y., Fukuhara S., Nagase T., Tomita T., Hitomi S., Kimura S., Kurihara H., Ouchi Y. J. Biol. Chem. 276:31510-31514 (2001)
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.