Recombinant Pig Platelet factor 4 (PF4)

CAT:
399-CSB-YP017809PI-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Pig Platelet factor 4 (PF4) - image 1

Recombinant Pig Platelet factor 4 (PF4)

  • CAS Number:

    9000-83-3
  • Gene Name:

    PF4
  • UniProt:

    P30034
  • Expression Region:

    1-90aa
  • Organism:

    Sus scrofa
  • Target Sequence:

    QEWSLPGTRVPPPADPEGGDANLRCVCVKTISGVSPKHISSLEVIGAGPHCPSPQLIATLKKGHKICLDPQNLLYKKIIKKLLKSQLLTA
  • Tag:

    N-terminal mFc-tagged
  • Source:

    Yeast
  • Field of Research:

    Cardiovascular
  • Assay Type:

    Developed Protein
  • Relevance:

    Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation.
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Length:

    Full Length
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    36.7 kDa
  • References & Citations:

    "The complete primary structure of glycosylated porcine platelet factor 4." Proudfoot A.E.I., Magnenat E., Haley T.M., Maione T.E., Wells T.N.C. Eur. J. Biochem. 228:658-664 (1995)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.