Recombinant Mouse Myelin-oligodendrocyte glycoprotein (Mog) , partial

• CAS Number:

  9000-83-3

• Gene Name:

  Mog

• UniProt:

  Q61885

• Expression Region:

  29-156aa

• Organism:

  Mus musculus

• Target Sequence:

  GQFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAMELKVEDPFYWVNPGVLT

• Tag:

  C-terminal hFc-tagged

• Source:

  Mammalian cell

• Field of Research:

  Neuroscience

• Assay Type:

  Developed Protein

• Relevance:

  Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication. Mediates homophilic cell-cell adhesion.

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Length:

  Partial

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  43.5 kDa

• References & Citations:

  "The crystal structure of myelin oligodendrocyte glycoprotein, a key autoantigen in multiple sclerosis." Clements C.S., Reid H.H., Beddoe T., Tynan F.E., Perugini M.A., Johns T.G., Bernard C.C., Rossjohn J. Proc. Natl. Acad. Sci. U.S.A. 100:11059-11064 (2003)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.