Tubby Antibody

Tubby Antibody

• Description: Tubby protein homolog is a protein that in humans is encoded by the TUB gene. This gene encodes a member of the Tubby family of bipartite transcription factors. The encoded protein may play a role in obesity and sensorineural degradation. The crystal structure has been determined for a similar protein in mouse, and it functions as a membrane-bound transcription regulator that translocates to the nucleus in response to phosphoinositide hydrolysis. Two transcript variants encoding distinct isoforms have been identified for this gene.
• CAS Number: 9007-83-4
• UniProt: P50607
• Host: Rabbit
• Immunogen: Amino acids 395-429 (VHERVSIRPRNEHETLLARWQNKNTESIIELQNKT) from the human protein were used as the immunogen for the Tubby antibody.
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB, FACS
• Format: Antigen affinity purified
• Buffer: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Reconstitution: After reconstitution, the Tubby antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
• Limitations: This Tubby antibody is available for research use only.