Recombinant Calotropis procera Osmotin, partial
CAT:
399-CSB-EP309242CBJ-02
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Calotropis procera Osmotin, partial
- CAS Number: 9000-83-3
- UniProt: P86363
- Expression Region: 1-40aa
- Organism: Calotropis procera (Roostertree) (Asclepias procera)
- Target Sequence: ATFTIRNNCPYTIWAAAVPGGGRRLNSGGTWTINVAPGTA
- Tag: N-terminal 6xHis-KSI-tagged
- Source: E.coli
- Field of Research: Others
- Assay Type: Developed Protein
- Relevance: Has antifungal activity. Inhibits spore germination and mycelia growth in F.solani (IC (50)=67.0 ug/ml), C.gloeosporioides (IC (50)=32.1 ug/ml) and a Neurospora isolate (IC (50)=57.5 ug/ml).
- Purity: Greater than 90% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Partial
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 19.5 kDa
- References & Citations: "Osmotin purified from the latex of Calotropis procera: Biochemical characterization, biological activity and role in plant defense." Teixeira de Freitas C.D., Sousa Nogueira F.C., Vasconcelos I.M., Abreu Oliveira J.T., Domont G.B., Ramos M.V. Plant Physiol. Biochem. 49:738-743 (2011)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.