Recombinant Human ADP/ATP translocase 3 (SLC25A6) , partial

CAT:
399-CSB-EP021520HU1-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human ADP/ATP translocase 3 (SLC25A6) , partial - image 1

Recombinant Human ADP/ATP translocase 3 (SLC25A6) , partial

  • CAS Number:

    9000-83-3
  • Gene Name:

    SLC25A6
  • UniProt:

    P12236
  • Expression Region:

    232-272aa
  • Organism:

    Homo sapiens
  • Target Sequence:

    DTVRRRMMMQSGRKGADIMYTGTVDCWRKIFRDEGGKAFFK
  • Tag:

    N-terminal 6xHis-KSI-tagged
  • Source:

    E.coli
  • Field of Research:

    Cell Biology
  • Assay Type:

    In Stock Protein
  • Relevance:

    ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis, and export of ATP out to fuel the cell . Cycles between the cytoplasmic-open state (c-state) and the matrix-open state (m-state): operates by the alternating access mechanism with a single substrate-binding site intermittently exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane . In addition to its ADP:ATP antiporter activity, also involved in mitochondrial uncoupling and mitochondrial permeability transition pore (mPTP) activity . Plays a role in mitochondrial uncoupling by acting as a proton transporter: proton transport uncouples the proton flows via the electron transport chain and ATP synthase to reduce the efficiency of ATP production and cause mitochondrial thermogenesis . Proton transporter activity is inhibited by ADP:ATP antiporter activity, suggesting that SLC25A6/ANT3 acts as a master regulator of mitochondrial energy output by maintaining a delicate balance between ATP production (ADP:ATP antiporter activity) and thermogenesis (proton transporter activity) . Proton transporter activity requires free fatty acids as cofactor, but does not transport it . Also plays a key role in mPTP opening, a non-specific pore that enables free passage of the mitochondrial membranes to solutes of up to 1.5 kDa, and which contributes to cell death . It is however unclear if SLC25A6/ANT3 constitutes a pore-forming component of mPTP or regulates it .
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Length:

    Partial
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    20.2 kDa
  • References & Citations:

    "Study of PTPC composition during apoptosis for identification of viral protein target." Verrier F., Mignotte B., Jan G., Brenner C. Ann. N. Y. Acad. Sci. 1010:126-142 (2003)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.