Recombinant Rhesus Macaque CSF3 protein (CSF3) , partial (Active)

CAT:
399-CSB-AP003201MOW-01
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Rhesus Macaque CSF3 protein (CSF3) , partial (Active) - image 1

Recombinant Rhesus Macaque CSF3 protein (CSF3) , partial (Active)

  • CAS Number:

    9000-83-3
  • Gene Name:

    CSF3
  • UniProt:

    F7H1Q6
  • Expression Region:

    27-200aa
  • Organism:

    Macaca mulatta (Rhesus macaque)
  • Target Sequence:

    TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLRHSLGIPWAPLSSCPSQALQLTGCLSQLHSSLFLYQGLLQALEGISPELSPTLDTLQLDIADFATTIWQQMEDLGMAPALQPTQGAMPAFTSAFQRRAGGVLVASHLQRFLELAYRVLRHLAQS
  • Tag:

    Tag-Free
  • Source:

    E.Coli
  • Field of Research:

    Immunology
  • Assay Type:

    Active Protein & In Stock Protein
  • Endotoxin:

    Less than 1.0 EU/µg as determined by LAL method.
  • Purity:

    >98% as determined by SDS-PAGE.
  • Activity:

    Yes
  • Bioactivity:

    Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine NFS-60 cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 × 107 IU/mg.
  • Length:

    Partial of NW_01480557
  • Form:

    Lyophilized powder
  • Buffer:

    Lyophilized from a 0.2 µm filtered PBS, pH 7.4
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    18.9 kDa
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.