Recombinant Macaca fascicularis Zinc transporter ZIP6 isoform X1 (SLC39A6) , partial (Active)
CAT:
399-CSB-BP5043MOV-01
Size:
20 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
















Recombinant Macaca fascicularis Zinc transporter ZIP6 isoform X1 (SLC39A6) , partial (Active)
- CAS Number: 9000-83-3
- Gene Name: SLC39A6
- UniProt: XP_005586923.1
- Expression Region: 21-309aa
- Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
- Target Sequence: LHELKSAAAFPQTTEKISPNWESGINVDLAITTRQYHLQQLFYRYGENNSLSVEGFRKLLQNIGIDKIKRIHIHHDHDHHSDHEHHSDHEHHSDHEHHSHRNHAASGKNKRKALCPEHDSDSSGKDPRNSQGKGAHRPEHANGRRNVKDSVSTSEVTSTVYNTVSEGTHFLETIETPKLFPKDVSSSTPPSVTEKSLVSRLAGRKTNESMSEPRKGFMYSRNTNENPQECFNASKLLTSHGMGIQVPLNATEFNYLCPAIINQIDARSCLIHTSEKKAEIPPKTYSLQI
- Tag: C-terminal 6xHis-tagged
- Source: Baculovirus
- Field of Research: Cancer
- Assay Type: Active Protein & In Stock Protein
- Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
- Purity: Greater than 95% as determined by SDS-PAGE.
- Activity: Yes
- Bioactivity: Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus SLC39A6 at 2 μg/mL can bind Anti-SLC39A6 recombinant antibody (CSB-RA621669MA1HU). The EC50 is 0.8290-0.9864 ng/mL.
- Length: Partial
- Form: Lyophilized powder
- Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 33.6 kDa
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.