Recombinant Rat D-dopachrome decarboxylase (Ddt)

• CAS Number:

  9000-83-3
• Gene Name:

  Ddt
• UniProt:

  P80254
• Expression Region:

  2-118aa
• Organism:

  Rattus norvegicus
• Target Sequence:

  PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLISSIGVVGTAEQNRSHSSSFFKFLTEELSLDQDRIIIRFFPLEPWQIGKKGTVMTFL
• Tag:

  N-terminal 10xHis-tagged and C-terminal Myc-tagged
• Source:

  E.coli
• Field of Research:

  Cell Biology
• Assay Type:

  In Stock Protein
• Relevance:

  Tautomerization of D-dopachrome with decarboxylation to give 5, 6-dihydroxyindole (DHI).
• Purity:

  Greater than 85% as determined by SDS-PAGE.
• Activity:

  Not Test
• Length:

  Full Length of Mature Protein
• Form:

  Liquid or Lyophilized powder
• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Molecular Weight:

  20.4 kDa
• References & Citations:

  "Cloning and sequencing of a cDNA encoding rat D-dopachrome tautomerase." Zhang M., Aman P., Grubb A., Panagopoulos I., Hindemith A., Rosengren E., Rorsman H. FEBS Lett. 373:203-206 (1995)
• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.