Recombinant Human Insulin (INS), partial

CAT:
399-CSB-YP011742HU-WD-01
Size:
100 mg

For Laboratory Research Only. Not for Clinical or Personal Use.

  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Insulin (INS), partial - image 1

Recombinant Human Insulin (INS), partial

  • Product Name Alternative:

    Insulin; INS; IDDM; ILPR; IRDN; MODY10
  • Abbreviation:

    Recombinant Human Insulin protein, partial
  • Gene Name:

    Insulin
  • UniProt:

    P01308
  • Expression Region:

    25-54aa&90-110aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    GIVEQCCTSICSLYQLENYCN&FVNQHLCGSHLVEALYLVCGERGFFYTPKT
  • Tag:

    Tag free
  • Type:

    In Stock Protein
  • Source:

    Yeast
  • Field of Research:

    Others
  • Endotoxin:

    ≤20 EU/mg by the LAL method
  • Purity:

    Greater than 95% as determined by SDS-PAGE.
  • Activity:

    Not test
  • Form:

    Lyophilized powder
  • Buffer:

    Lyophilized from a 0.2 μm filtered solution (It is recommended to redissolve in sterile 0.01 M HCl at a concentration of not less than 1mg/mL.)
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    5.8 kDa
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Partial