Recombinant Human Insulin (INS), partial

• Product Name Alternative:

  Insulin; INS; IDDM; ILPR; IRDN; MODY10

• Abbreviation:

  Recombinant Human Insulin protein, partial

• Gene Name:

  Insulin

• UniProt:

  P01308

• Expression Region:

  25-54aa&90-110aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  GIVEQCCTSICSLYQLENYCN&FVNQHLCGSHLVEALYLVCGERGFFYTPKT

• Tag:

  Tag free

• Type:

  In Stock Protein

• Source:

  Yeast

• Field of Research:

  Others

• Endotoxin:

  ≤20 EU/mg by the LAL method

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Activity:

  Not test

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm filtered solution (It is recommended to redissolve in sterile 0.01 M HCl at a concentration of not less than 1mg/mL.)

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  5.8 kDa

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial