Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1) , partial

• CAS Number:

  9000-83-3
• Gene Name:

  Lrpap1
• UniProt:

  P55302
• Expression Region:

  248-360aa
• Organism:

  Mus musculus
• Target Sequence:

  GYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQLEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL
• Tag:

  Tag-Free
• Source:

  E.coli
• Field of Research:

  Cardiovascular
• Assay Type:

  Developed Protein
• Purity:

  Greater than 90% as determined by SDS-PAGE.
• Activity:

  Not Test
• Length:

  Partial
• Form:

  Liquid or Lyophilized powder
• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Molecular Weight:

  40.5 kDa
• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.