Login

Recombinant Human Platelet basic protein (PPBP) , partial (Active)

CAT:
399-CSB-AP000701HU-03
Size:
500 µg
Price:
Ask
For price, please contact [email protected]
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Platelet basic protein (PPBP) , partial (Active) - image 1
Recombinant Human Platelet basic protein (PPBP) , partial (Active) - image 2
Thumbnail 1
Thumbnail 2

Recombinant Human Platelet basic protein (PPBP) , partial (Active)

  • CAS Number: 9000-83-3
  • Gene Name: PPBP, CTAP3, CXCL7, SCYB7, TGB1, THBGB1
  • UniProt: P02775
  • Expression Region: 59-128aa
  • Organism: Homo sapiens
  • Target Sequence: AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
  • Tag: Tag-Free
  • Source: E.Coli
  • Field of Research: Immunology
  • Assay Type: Active Protein & In Stock Protein
  • Relevance: LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2 (73), NAP-2 (74), NAP-2 (1-66), and most potent NAP-2 (1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III (1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation. {ECO:0000269|PubMed:10877842, ECO:0000269|PubMed:7890771, ECO:0000269|PubMed:8950790, ECO:0000269|PubMed:9794434}.
  • Endotoxin: Less than 1.0 EU/µg as determined by LAL method.
  • Purity: >97% as determined by SDS-PAGE.
  • Activity: Yes
  • Bioactivity: Fully biologically active when compared to standard. The biological activity determined by a chemotaXIs bioassay using human peripheral blood neutrophils is in a concentration range of 1.0-10.0 ng/ml.
  • Length: Partial
  • Form: Lyophilized powder
  • Buffer: Lyophilized from a 0.2 µm filtered PBS, pH 7.4
  • Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function: LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2 (73), NAP-2 (74), NAP-2 (1-66), and most potent NAP-2 (1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III (1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation.
  • Molecular Weight: 7.6 kDa
  • Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.