Recombinant Human B-cell antigen receptor complex-associated protein alpha chain (CD79A) , partial (Active)

Recombinant Human B-cell antigen receptor complex-associated protein alpha chain (CD79A) , partial (Active)

• CAS Number: 9000-83-3
• Gene Name: CD79A
• UniProt: P11912
• Expression Region: 33-143aa
• Organism: Homo sapiens
• Target Sequence: LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR
• Tag: C-terminal 10xHis-tagged
• Source: Mammalian cell
• Field of Research: Immunology
• Assay Type: Active Protein & In Stock Protein
• Relevance: Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B-cells.
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Purity: Greater than 90% as determined by SDS-PAGE.
• Activity: Yes
• Bioactivity: Measured by its binding ability in a functional ELISA. Immobilized Human CD79A at 2 μg/mL can bind Anti-CD79A recombinant antibody (CSB-RA004957MA1HU). The EC50 is 1.521-1.700 ng/mL.
• Length: Partial
• Form: Lyophilized powder
• Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Molecular Weight: 13.9kDa
• References & Citations: Immunoglobulin A levels and its correlation with neutrophil-to-lymphocyte ratio as inflammatory biomarkers for dry eye disease in type 2 diabetes: a retrospective study. Alhalwani A.Y., Abudawood K., Qadizadah A.B.E.A., Jambi S., Sannan N.S. Front Immunol 14:1184862-1184862 (2023)
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Protein Length: Partial