Leptin pegylated antagonist (mutant L39A/D40A/F41A) Recombinant Protein

• Description:

  Mono-pegylated (with 20 kDa PEG) recombinant human leptin antagonist is one polypeptide chain containing 146 amino, an additional Ala at N-terminus and one molecule of PEG 20 kDa at its N-terminus, having an expected molecular mass of ~ 35.6 kDa as determined by MS. However due to enlarged hydrodymanic volume recombinant human leptin antagonist runs on the SDS-PAGE as 48 kDa protein and in gel-filtration on Superdex 200 as over 200 kDa protein. Human pegylated recombinant leptin antagonist half-life in circulation after SC injection was over 20 hours. Human pegylated recombinant leptin antagonist was initially mutated, resulting in L39A/D40A/F41A mutant that was purified by proprietary chromatographic techniques according to Niv-Spector et al, Biochem. J 291;221-230 (2005). and its pegylation was similar to that is described in Elinav et al. for mouse leptin antagonist see Endocrinology 150:3083-91 (2009).

• Synonyms:

  Lep; ob; obese

• CAS Number:

  9000-83-3

• NCBI Gene ID:

  3952

• UniProt:

  P41159

• Accession Number:

  NP_000221.1

• Accession Number mRNA:

  NM_000230

• Host:

  E. coli

• Origin Species:

  Human

• Species Reactivity:

  Human

• Tag:

  PEG

• Sequence:

  AVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGAAAIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC

• Detection Range:

  Recombinant human pegylated leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. Its in vitro activity is 6-8 fold lower than the non-pegylated human leptin antagonist but in vivo it has profound weight gain effect in mice (as compared to the non-pegylated human leptin antagonist ), resulting mainly from increased food intake.

• Endotoxin:

  < 0.1 ng/µg of protein (<1EU/µg)

• Purity:

  > 98.0% as determined by Gel filtration and SDS-PAGE gel.

• Length:

  146

• Form:

  Lyophilized

• Reconstitution:

  It is recommended to reconstitute the lyophilized pegylated recombinant human pegylated leptin antagonist in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions.

• Molecular Weight:

  35.6 kDa

• Shipping Conditions:

  Room Temperature

• N Terminal Sequence:

  AVPIQ